| Desktop | 64/100 | ❗ |
| Mobile | 31/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 66 KB | ✔ |
| Compression | 16 KB (-75.6%) | ✔ |
| Text/Html Ratio | 483 / 67940 (bytes) = 0.71% | ✘ |
| Load Time | 1.45 second | ✘ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 3 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | English | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 2 / 3 | ✘ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | No | ✘ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| 3 | ✘ | ✘ | ✘ | |
| site | 2 | ✘ | ✘ | ✘ |
| sign | 1 | ✘ | ✘ | ✘ |
| life | 1 | ✔ | ✔ | ✘ |
| with this | 1 | ✘ | ✘ | ✘ |
| free | 1 | ✘ | ✔ | ✘ |
| click | 1 | ✘ | ✘ | ✘ |
| here | 1 | ✘ | ✘ | ✘ |
| part | 1 | ✘ | ✘ | ✘ |
| website | 1 | ✘ | ✘ | ✘ |
| endorsed | 1 | ✘ | ✘ | ✘ |
| trademark | 1 | ✘ | ✘ | ✘ |
| change | 1 | ✘ | ✔ | ✘ |
| morning | 1 | ✘ | ✔ | ✘ |
| full | 1 | ✘ | ✘ | ✘ |
|
With 1.45 seconds in page load, 66 KB of page size and all other reports below, the the21dayflatbellyfixsystem.com has a SEO score of 60 out of 100 |
| Title | Say YES to life! |
| Description | Discover how This "MORNING RITUAL" can change your LIFE with this free video |
| Keyword | flat belly, health, wellness |
| Age | 0 Years, 2 Days |
| Created | 19th-Oct-2020 |
| Updated | 19th-Oct-2020 |
| Expiry | 19th-Oct-2021 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| the21dayflatbellyfixsystem.com | A | 580 | ip:184.168.131.241 |
| the21dayflatbellyfixsystem.com | NS | 3600 | target:ns51.domaincontrol.com |
| the21dayflatbellyfixsystem.com | NS | 3600 | target:ns52.domaincontrol.com |
| the21dayflatbellyfixsystem.com | SOA | 3600 | mname:ns51.domaincontrol.comrname:dns.jomax.netserial:2020102000refresh:28800retry:7200expire:604800minimum-ttl:600 |
|
Domain Name: the21dayflatbellyfixsystem.com Registry Domain ID: 2566949093_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.godaddy.com Registrar URL: http://www.godaddy.com Updated Date: 2020-10-19T20:21:10Z Creation Date: 2020-10-19T20:21:09Z Registrar Registration Expiration Date: 2021-10-19T20:21:09Z Registrar: GoDaddy.com, LLC Registrar IANA ID: 146 Registrar Abuse Contact Email: abuse@godaddy.com Registrar Abuse Contact Phone: +1.4806242505 Domain Status: clientTransferProhibited http://www.icann.org/epp#clientTransferProhibited Domain Status: clientUpdateProhibited http://www.icann.org/epp#clientUpdateProhibited Domain Status: clientRenewProhibited http://www.icann.org/epp#clientRenewProhibited Domain Status: clientDeleteProhibited http://www.icann.org/epp#clientDeleteProhibited Registrant Organization: Registrant State/Province: Mississippi Registrant Country: US Registrant Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=the21dayflatbellyfixsystem.com Admin Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=the21dayflatbellyfixsystem.com Tech Email: Select Contact Domain Holder link at https://www.godaddy.com/whois/results.aspx?domain=the21dayflatbellyfixsystem.com Name Server: NS51.DOMAINCONTROL.COM Name Server: NS52.DOMAINCONTROL.COM DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: http://wdprs.internic.net/ >>> Last update of WHOIS database: 2020-10-21T11:00:00Z |
| Server IP | 184.168.131.241 |
| Server Location | United States |
| Service Provider | GoDaddy.com, LLC |
| Domains (TLD) | Status |
|---|---|
| the21dayflatbellyfixsystem.net | Available |
| the21dayflatbellyfixsystem.org | Already Registered |
| the21dayflatbellyfixsystem.biz | Already Registered |
| the21dayflatbellyfixsystem.io | Already Registered |
| the21dayflatbellyfixsystem.info | Available |
| Domains (TLD) | Status |
|---|---|
| the21dayflatbelyfixsystem.com | Available |
| rhe21dayflatbellyfixsystem.com | Available |
| fhe21dayflatbellyfixsystem.com | Available |
| ghe21dayflatbellyfixsystem.com | Available |
| hhe21dayflatbellyfixsystem.com | Available |
| Procareerfocus.com |
| Xbnlive.com |
| Yourprivateproducts.com |
| Victoriaclementi.com |
| Volkswagenrepairwestspringfieldma.com |
| Pandemic-richie.com |
| Nubesttall.net |
| Chollozonbuyvip.com |
| Agridrill.com |
| Amarascreations.com |